EUR
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
English
Slovenščina Slovenščina
0 items
New Products
Product Details
Substrate for Drosera
Substrate for Drosera
Brand:Diversiflora
Product Code:SubstrDros
Product Condition:New
5,00 € inc. tax
Add to Cart
Description
Substrate mix for subtropical and temperate Drosera. 2L package. This is the soil mix we make and use for our plants. Mixed from natural Baltic peat and perlite. No additives, pH around 3.
Soak in rainwater before use.
Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Register to earnLoyalty points
Loyalty Program
Join our VIP rewards program today!
Register to earn Loyalty points
Points mean prizes!
Ways to earn
Welcome gift
Place an order
Write a review
Newsletter signup
see more..
Ways to redeem
see more..
Join today
Already have an account?Sign in